DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and olig4

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001039180.1 Gene:olig4 / 734024 XenbaseID:XB-GENE-484736 Length:209 Species:Xenopus tropicalis


Alignment Length:137 Identity:57/137 - (41%)
Similarity:82/137 - (59%) Gaps:17/137 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 GASGSGSNSGKQKNRQGKTVRLNINARERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLL 174
            |...:|.....|:|:.  .:||.:|:|||:||||||.|:|.||.|:||:|.|||||||||:||:|
 Frog    42 GRVKAGKRELTQENQH--ELRLKVNSRERQRMHDLNQAMDGLREVMPYSHGPSVRKLSKISTLIL 104

  Fly   175 AKNYILMQQNALEELRRLLAYI---QSTTGAA----------PLDLGAFPAA--AKLQALLQGPH 224
            |:|||:|..|:|||::||:..:   |...|.|          |..:...||:  |...:|.....
 Frog   105 ARNYIVMLSNSLEEMKRLVNEVYGAQRAPGCASSLSTRVPQLPPVMPTVPASDYATYLSLSSSDI 169

  Fly   225 NEPPTSS 231
            .:||.::
 Frog   170 CQPPATA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 37/53 (70%)
olig4NP_001039180.1 bHLH_TS_OLIG2_like 59..121 CDD:381568 41/61 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.