DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and Atoh8

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_722473.1 Gene:Atoh8 / 71093 MGIID:1918343 Length:322 Species:Mus musculus


Alignment Length:219 Identity:59/219 - (26%)
Similarity:84/219 - (38%) Gaps:66/219 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PGLPNHGHMPIPPTANMLGGQHP-----------------APTASPPQSVPGRRTPLGSVGLGGF 58
            ||||.   .|.||.:..|....|                 ||.|.|.||.|              
Mouse   121 PGLPT---PPPPPASQSLAPGDPEAHSFREQALRPRILLCAPPARPTQSAP-------------- 168

  Fly    59 YAQGMGMSQQPPT--DENKPGPSAPEKPLSPTAAAIAAIAISGGTTTVAVSSGGASGSGSNSGKQ 121
                    ..||.  .|:...|:.|.:|...:.::|:.:..:....:.| |.....|..:.:..:
Mouse   169 --------LAPPAAPQESPVRPAPPTRPGESSYSSISHVIYNNHPDSSA-SPRKRPGEATAASTE 224

  Fly   122 KNRQGKTVRLNINARERRRMHDLNDALDELRSVIP-YAHSPSVRKLSKIATLLLAKNYILMQQNA 185
            .....:|.||..|||||.|:|.::.|.:.||..:| |::.   :||||:|.|.:|.||||     
Mouse   225 IKALQQTRRLLANARERTRVHTISAAFEALRKQVPCYSYG---QKLSKLAILRIACNYIL----- 281

  Fly   186 LEELRRLLAYIQSTTGAAPLDLGA 209
              .|.||          |.||..|
Mouse   282 --SLARL----------ADLDYSA 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 23/54 (43%)
Atoh8NP_722473.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..96
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..144 9/25 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..221 16/84 (19%)
Basic motif, degenerate. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 231..244 8/12 (67%)
HLH 232..283 CDD:278439 25/60 (42%)
Helix-loop-helix motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 245..283 17/47 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.