DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and NEUROG2

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_076924.1 Gene:NEUROG2 / 63973 HGNCID:13805 Length:272 Species:Homo sapiens


Alignment Length:245 Identity:71/245 - (28%)
Similarity:85/245 - (34%) Gaps:77/245 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MLGGQHPAPTASPPQSVPGRRTPLGSVGLGGFYAQGMGMSQQPPTDENKPGPSAPEKPLSPTAAA 91
            :||...||..|..|.|                       |.....:|.:||.|...:   ....|
Human    19 LLGSASPALAALTPLS-----------------------SSADEEEEEEPGASGGAR---RQRGA 57

  Fly    92 IAAIAISGGTTTVAVSSGG---------------------ASGSGSNSGKQKNRQGKTVRLNINA 135
            .|.....||   ||..:.|                     |...|:.:.:...|..||.||..|.
Human    58 EAGQGARGG---VAAGAEGCRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANN 119

  Fly   136 RERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYILMQQNALEELRRLLAYIQSTT 200
            |||.|||:||.|||.||.|:|  ..|...||:||.||..|.|||.    ||.|..||..:.....
Human   120 RERNRMHNLNAALDALREVLP--TFPEDAKLTKIETLRFAHNYIW----ALTETLRLADHCGGGG 178

  Fly   201 GAAPLDLGAF----------PAAAKLQALLQGPH--------NEPPTSSS 232
            |..|   ||.          .|:|.|.:....|.        |.|..|||
Human   179 GGLP---GALFSEAVLLSPGGASAALSSSGDSPSPASTWSCTNSPAPSSS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 29/53 (55%)
NEUROG2NP_076924.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..69 12/67 (18%)
bHLH_TS_NGN2_ATOH4 104..172 CDD:381560 37/73 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..264 9/29 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145403
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.