DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and Bhlhe22

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_067535.3 Gene:Bhlhe22 / 59058 MGIID:1930001 Length:355 Species:Mus musculus


Alignment Length:276 Identity:111/276 - (40%)
Similarity:136/276 - (49%) Gaps:64/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PGLPNHGHMPIPPTANMLGGQHPAPTASPPQSVPGRRTPLGSVGLG------------------- 56
            |..|....:.:||.    ||...|.......||||  ..:||.|:|                   
Mouse    66 PADPEGAGLLLPPP----GGGGGASGGGGGVSVPG--LLVGSAGVGGEPSLSSLPAGAALCLKYG 124

  Fly    57 -----GFYAQGMGMSQQPPTDENKPG-------PSAPEKPLSPTAAAIAAIAISG---------- 99
                 |..|:..|..|.|  |::..|       ...|:...||.|...:|....|          
Mouse   125 ESAGRGSVAESSGGEQSP--DDDSDGRCELVLRAGGPDPRASPGAGGGSAKVAEGCSNAHLHGGS 187

  Fly   100 GTTTVAVSSGGASGSGSNSGKQKNRQGKTVRLNINARERRRMHDLNDALDELRSVIPYAHSPSVR 164
            |......:|||.||.|.....:|:::.|.:|||||||||||||||||||||||:|||||||||||
Mouse   188 GLPPGGPTSGGGSGGGGGGSSKKSKEQKALRLNINARERRRMHDLNDALDELRAVIPYAHSPSVR 252

  Fly   165 KLSKIATLLLAKNYILMQQNALEELRRLLAYI---QSTTGAA-PLDLGAFPAAAKLQALLQGPHN 225
            ||||||||||||||||||..||||:|||:||:   |:.:.|: |....|..|||.|...| |.:.
Mouse   253 KLSKIATLLLAKNYILMQAQALEEMRRLVAYLNQGQAISAASLPSSAAAAAAAAALHPAL-GAYE 316

  Fly   226 E----------PPTSS 231
            :          ||.:|
Mouse   317 QAAGYPFSAGLPPAAS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 50/53 (94%)
Bhlhe22NP_067535.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..90 7/27 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..215 21/88 (24%)
HLH 222..276 CDD:197674 50/53 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6878
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4396
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1617813at2759
OrthoFinder 1 1.000 - - FOG0002346
OrthoInspector 1 1.000 - - otm43565
orthoMCL 1 0.900 - - OOG6_106693
Panther 1 1.100 - - LDO PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5479
SonicParanoid 1 1.000 - - X1548
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.