DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and NEUROD4

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_067014.2 Gene:NEUROD4 / 58158 HGNCID:13802 Length:331 Species:Homo sapiens


Alignment Length:159 Identity:48/159 - (30%)
Similarity:67/159 - (42%) Gaps:47/159 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 QGMGMSQQPPTDENKPGPSAPEKPLSPTAAAIAAIAISGGTTTVAVSSGGASGSGSNSGKQKNRQ 125
            :|:|...:...:|::||          |...::::       |....|..........|::..|:
Human    23 KGLGSQNEVKEEESRPG----------TYGMLSSL-------TEEHDSIEEEEEEEEDGEKPKRR 70

  Fly   126 G--------------KTVRLNINARERRRMHDLNDALDELRSVIP-YAHSPSVRKLSKIATLLLA 175
            |              :..|:..|||||.|||.||||||.||.|:| |:   ..:|||||.||.||
Human    71 GPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYS---KTQKLSKIETLRLA 132

  Fly   176 KNYILMQQNALEELRRLLAYIQSTTGAAP 204
            :|||......||            ||..|
Human   133 RNYIWALSEVLE------------TGQTP 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 32/54 (59%)
NEUROD4NP_067014.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..80 11/73 (15%)
HLH 88..144 CDD:238036 32/58 (55%)
Neuro_bHLH 146..264 CDD:289310 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..265
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.