DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and Neurod2

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_062199.2 Gene:Neurod2 / 54276 RGDID:3166 Length:382 Species:Rattus norvegicus


Alignment Length:224 Identity:70/224 - (31%)
Similarity:90/224 - (40%) Gaps:71/224 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FGFPGLPNHGHMPIPPTANMLGGQHPAPTA----SPPQSVPGRRTPLGSVGLGGFYAQGMGMSQQ 68
            |..|||.:    .:|..|:...|....|.:    :|||..|               |.|.|    
  Rat     6 FSEPGLLS----DVPKFASWGDGDDDEPRSDKGDAPPQPPP---------------APGSG---- 47

  Fly    69 PPTDENKPGPSAPEKPLS--------PTAAAIAAIAISGGTTTVAVSSGGASGSGSNSGKQKNRQ 125
                  .|||:...||:|        ||.|.:......||........  ..|.....|::..::
  Rat    48 ------APGPARATKPVSLRGEEVPEPTLAEVKEEGELGGEEEEEEEE--EEGLDEAEGERPKKR 104

  Fly   126 G--------------KTVRLNINARERRRMHDLNDALDELRSVIP-YAHSPSVRKLSKIATLLLA 175
            |              |..|...|||||.||||||.|||.||.|:| |:   ..:|||||.||.||
  Rat   105 GPKKRKMTKARLERSKLRRQKANARERNRMHDLNAALDNLRKVVPCYS---KTQKLSKIETLRLA 166

  Fly   176 KNYILMQQNALEELRR------LLAYIQS 198
            ||||.    ||.|:.|      |::|:|:
  Rat   167 KNYIW----ALSEILRSGKRPDLVSYVQT 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 34/54 (63%)
Neurod2NP_062199.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..129 32/153 (21%)
bHLH_TS_NeuroD2 88..180 CDD:381563 41/100 (41%)
Nuclear localization signal. /evidence=ECO:0000255 107..113 0/5 (0%)
Neuro_bHLH 180..310 CDD:403655 3/12 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.