DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and Atoh1

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001102708.1 Gene:Atoh1 / 500156 RGDID:1565171 Length:351 Species:Rattus norvegicus


Alignment Length:262 Identity:75/262 - (28%)
Similarity:96/262 - (36%) Gaps:80/262 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QHPAP------TASPPQSVPGRRTPLGSVGLG----------------G----------FYAQGM 63
            :||.|      |..||.::..|..|:....|.                |          .::..:
  Rat    21 RHPQPHHIPQLTPQPPATLQARDHPVYPAELSLLDSTDPRAWLTPTLQGLCTARAAQYLLHSPEL 85

  Fly    64 GMSQ-QPPTDE--------NKPGPSAPEKPLSPTAAAIAAIAISGGTTTVAVSSGGASGSGSNSG 119
            |.|: ..|.||        .:.|.....|...|.........:.||   |.|...|.|...:.|.
  Rat    86 GASEAAAPGDEADGQGELVRRSGCGGLSKSPGPVKVREQLCKLKGG---VVVDELGCSRQRAPSS 147

  Fly   120 KQKNRQGKTVRLNINARERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYILMQQN 184
            ||.|...|..||..|||||||||.||.|.|:||:|||..::.  :||||..||.:|:.||    |
  Rat   148 KQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNND--KKLSKYETLQMAQIYI----N 206

  Fly   185 ALEEL-----------------------RRLLAYIQSTTGAAPLDLGAFPAAAKLQALLQGPHNE 226
            ||.||                       .|..|..:...||:.: .||.||..      .||...
  Rat   207 ALSELLQTPSVGEQPPPPAASCKNDHHHLRAAASYEGGAGASAV-AGAQPAPG------GGPRPT 264

  Fly   227 PP 228
            ||
  Rat   265 PP 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 30/53 (57%)
Atoh1NP_001102708.1 HLH 155..213 CDD:238036 35/63 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.