DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and Bhlhe23

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001102681.1 Gene:Bhlhe23 / 499952 RGDID:1559760 Length:223 Species:Rattus norvegicus


Alignment Length:176 Identity:86/176 - (48%)
Similarity:101/176 - (57%) Gaps:47/176 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GFYAQGMGMSQQPPTDENKPGPSAPEKPLSPTAAAIAAIAISGGTTTVAVSSGGASGSGSNS--- 118
            ||.|.|             ||...|..|.|...||           ||. |||..||....:   
  Rat    37 GFGASG-------------PGGDLPAAPASRVPAA-----------TVE-SSGEQSGDEDEAFER 76

  Fly   119 ------------GKQKNRQGKTVRLNINARERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIAT 171
                        .:::.|:.:::||:|||||||||||||||||.||:||||||||||||||||||
  Rat    77 RRRRRGPGVAVDARRRPREQRSLRLSINARERRRMHDLNDALDGLRAVIPYAHSPSVRKLSKIAT 141

  Fly   172 LLLAKNYILMQQNALEELRRLLAYI-QSTTGAAPLDLGAFPAAAKL 216
            |||||||||||..||||:|||:||: |..:.|||:      |||.|
  Rat   142 LLLAKNYILMQAQALEEMRRLVAYLNQGQSLAAPV------AAAPL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 49/53 (92%)
Bhlhe23NP_001102681.1 bHLH_TS_bHLHe22_bHLHb5 99..168 CDD:381524 59/68 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I4587
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1617813at2759
OrthoFinder 1 1.000 - - FOG0002346
OrthoInspector 1 1.000 - - otm45633
orthoMCL 1 0.900 - - OOG6_106693
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1548
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.