DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and NEUROG1

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_006152.2 Gene:NEUROG1 / 4762 HGNCID:7764 Length:237 Species:Homo sapiens


Alignment Length:146 Identity:46/146 - (31%)
Similarity:63/146 - (43%) Gaps:46/146 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 TDE----------NKPGPSAPEKPLSPTAAAIAAIAISGGTTTVAVSSGGASGSGSNSGKQKNRQ 125
            |||          :..||.||.:..:|..:..:.:                .|:..:..:::.|:
Human    27 TDEEDCARLQQAASASGPPAPARRGAPNISRASEV----------------PGAQDDEQERRRRR 75

  Fly   126 GKT--------------VRLNINARERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAK 176
            |:|              .|:..|.|||.|||:||.|||.||||:|  ..|...||:||.||..|.
Human    76 GRTRVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLP--SFPDDTKLTKIETLRFAY 138

  Fly   177 NYILMQQNALEELRRL 192
            |||.    ||.|..||
Human   139 NYIW----ALAETLRL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 30/53 (57%)
NEUROG1NP_006152.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..83 9/63 (14%)
HLH 90..149 CDD:238036 32/64 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..209
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145407
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.