DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and NEUROD2

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_006151.3 Gene:NEUROD2 / 4761 HGNCID:7763 Length:382 Species:Homo sapiens


Alignment Length:231 Identity:67/231 - (29%)
Similarity:88/231 - (38%) Gaps:85/231 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FGFPGLPNHGHMPIPPTANMLGGQHPAPTAS------PPQSVPGRRTPLGSVGLGGFYAQGMGMS 66
            |..|||.:    .:|..|:...|:...|.:.      ||...||                     
Human     6 FSEPGLLS----DVPKFASWGDGEDDEPRSDKGDAPPPPPPAPG--------------------- 45

  Fly    67 QQPPTDENKPGPSAPEKPL-----SPTAAAIAAIAISGGTTTVAVSSGG--------ASGSGSNS 118
                  ...|||:...||:     ..|.|.:|.:...|       ..||        ..|.....
Human    46 ------PGAPGPARAAKPVPLRGEEGTEATLAEVKEEG-------ELGGEEEEEEEEEEGLDEAE 97

  Fly   119 GKQKNRQG--------------KTVRLNINARERRRMHDLNDALDELRSVIP-YAHSPSVRKLSK 168
            |::..::|              |..|...|||||.||||||.|||.||.|:| |:   ..:||||
Human    98 GERPKKRGPKKRKMTKARLERSKLRRQKANARERNRMHDLNAALDNLRKVVPCYS---KTQKLSK 159

  Fly   169 IATLLLAKNYILMQQNALEELRR------LLAYIQS 198
            |.||.||||||.    ||.|:.|      |::|:|:
Human   160 IETLRLAKNYIW----ALSEILRSGKRPDLVSYVQT 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 34/54 (63%)
NEUROD2NP_006151.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..129 29/160 (18%)
bHLH_TS_NeuroD2 88..180 CDD:381563 41/98 (42%)
Nuclear localization signal. /evidence=ECO:0000255 107..113 0/5 (0%)
Neuro_bHLH 180..310 CDD:403655 3/12 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.