DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and tap

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster


Alignment Length:211 Identity:60/211 - (28%)
Similarity:76/211 - (36%) Gaps:58/211 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GQHPAPTASPPQS------VPGRRTPLGSVGL-----------GGFYAQGM------GMSQQPPT 71
            |..|.|....|.|      ||....|.|.|||           |....:.:      |:...|.|
  Fly    49 GTPPTPAIPQPYSGGTWDAVPLSSPPAGFVGLLDTSSNHSTRSGRTLVEHLNSRATNGVFDPPLT 113

  Fly    72 DENKPGPSAPEKPLSPTAAAIAAIAISGGTTTVAVSSGGASGSGSNSGKQKNRQGKTVRLNINAR 136
            ......|..|..|......|:       |...|         :.|.|..|..:..:..|:..|.|
  Fly   114 STPVKSPEDPNAPRPKRKYAV-------GKNRV---------TRSRSPTQVVKIKRFRRMKANDR 162

  Fly   137 ERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYILMQQNALEELRRLLAYIQSTTG 201
            ||.|||:|||||::||..:|  ..|...||:||..|..|.|||...:..||           :.|
  Fly   163 ERNRMHNLNDALEKLRVTLP--SLPEETKLTKIEILRFAHNYIFALEQVLE-----------SGG 214

  Fly   202 AAPLDLGAFPAAAKLQ 217
            :..|||      .|||
  Fly   215 SINLDL------EKLQ 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 26/53 (49%)
tapNP_524124.1 HLH 155..207 CDD:278439 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446164
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.