DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and bhlhe22

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_957249.2 Gene:bhlhe22 / 393930 ZFINID:ZDB-GENE-040426-1411 Length:261 Species:Danio rerio


Alignment Length:180 Identity:89/180 - (49%)
Similarity:104/180 - (57%) Gaps:33/180 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SQQPPT--DENKPGPSAPEKPLS----PTAAAIAAIAISGGTTTVAVSSGG-------------- 110
            ||.|.:  ::|.|.|..|.....    ||.:.......|...|:.|.||||              
Zfish    40 SQSPISCFEQNDPDPVQPGGRAGTLGLPTGSLCVKYGESANRTSGAESSGGEQSPDDDSDERCEM 104

  Fly   111 ---------ASGSGSNSGKQKNRQGKTVRLNINARERRRMHDLNDALDELRSVIPYAHSPSVRKL 166
                     ..|:.|..|| ||::.|.:|||||||||||||||||||||||:|||||||||||||
Zfish   105 MLMTDGRTTVPGAKSEGGK-KNKEQKMLRLNINARERRRMHDLNDALDELRAVIPYAHSPSVRKL 168

  Fly   167 SKIATLLLAKNYILMQQNALEELRRLLAYIQSTTGAAPLDLGAFPAAAKL 216
            ||||||||||||||||..||||:|||:||:..  |.| :...:.||...|
Zfish   169 SKIATLLLAKNYILMQAQALEEMRRLVAYLNQ--GQA-ISAASLPATTAL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 50/53 (94%)
bhlhe22NP_957249.2 HLH 136..190 CDD:197674 50/53 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6837
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4540
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1617813at2759
OrthoFinder 1 1.000 - - FOG0002346
OrthoInspector 1 1.000 - - otm24966
orthoMCL 1 0.900 - - OOG6_106693
Panther 1 1.100 - - LDO PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5479
SonicParanoid 1 1.000 - - X1548
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1212.000

Return to query results.
Submit another query.