DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and Bhlhe22

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001102410.1 Gene:Bhlhe22 / 365748 RGDID:1305451 Length:352 Species:Rattus norvegicus


Alignment Length:299 Identity:114/299 - (38%)
Similarity:139/299 - (46%) Gaps:106/299 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PPTANMLGGQHPAPTASP--------PQ--------------------SVPGRRTPLGSVGLG-- 56
            |||.     :.||.::||        |:                    ||||  ..:||.|:|  
  Rat    48 PPTR-----ERPASSSSPLGCFEPADPEGAGLLLPPPGGGGGASGGGVSVPG--LLVGSAGVGGE 105

  Fly    57 ----------------------GFYAQGMGMSQQPPTDENKPG-------PSAPEKPLSPTAAAI 92
                                  |..|:..|..|.|  |::..|       ...|:...||.|.  
  Rat   106 PSLSSLPAGAALCLKYGESAGRGSVAESSGGEQSP--DDDSDGRCELVLRAGGPDPRASPGAG-- 166

  Fly    93 AAIAISGGTTTVAVSS-------------GGASGSGSNSG---KQKNRQGKTVRLNINARERRRM 141
                 |||.......|             |..||||.|.|   .:|:::.|.:||||||||||||
  Rat   167 -----SGGAKVAEGCSNAHLHGGSGLPPGGPTSGSGGNGGGGSSKKSKEQKALRLNINARERRRM 226

  Fly   142 HDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYILMQQNALEELRRLLAYI---QSTTGAA 203
            |||||||||||:|||||||||||||||||||||||||||||..||||:|||:||:   |:.:.|:
  Rat   227 HDLNDALDELRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALEEMRRLVAYLNQGQAISAAS 291

  Fly   204 -PLDLGAFPAAAKLQALLQGPHNE----------PPTSS 231
             |....|..|||.|...| |.:.:          ||.:|
  Rat   292 LPSSAAAAAAAAALHPAL-GAYEQAAGYPFSAGLPPAAS 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 50/53 (94%)
Bhlhe22NP_001102410.1 HLH 219..273 CDD:197674 50/53 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6717
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I4587
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1617813at2759
OrthoFinder 1 1.000 - - FOG0002346
OrthoInspector 1 1.000 - - otm45633
orthoMCL 1 0.900 - - OOG6_106693
Panther 1 1.100 - - LDO PTHR19290
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1548
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.