powered by:
Protein Alignment Oli and hlh-32
DIOPT Version :9
Sequence 1: | NP_001188830.1 |
Gene: | Oli / 35066 |
FlyBaseID: | FBgn0032651 |
Length: | 232 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001023430.1 |
Gene: | hlh-32 / 3565279 |
WormBaseID: | WBGene00013665 |
Length: | 105 |
Species: | Caenorhabditis elegans |
Alignment Length: | 70 |
Identity: | 49/70 - (70%) |
Similarity: | 61/70 - (87%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 129 VRLNINARERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYILMQQNALEELRRLL 193
|||:||.|||.||||||:|||:||:||||||..||||||||||||||||:|:||..|:|||..|:
Worm 15 VRLSINLRERCRMHDLNEALDDLRAVIPYAHGGSVRKLSKIATLLLAKNHIIMQAKAIEELSVLV 79
Fly 194 AYIQS 198
:.:::
Worm 80 SQLKT 84
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160159978 |
Domainoid |
1 |
1.000 |
82 |
1.000 |
Domainoid score |
I5386 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3898 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1617813at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002346 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm14298 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_106693 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R5479 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1548 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
11 | 10.640 |
|
Return to query results.
Submit another query.