DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and ascl1b

DIOPT Version :10

Sequence 1:NP_523592.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_571306.1 Gene:ascl1b / 30478 ZFINID:ZDB-GENE-980526-174 Length:195 Species:Danio rerio


Alignment Length:98 Identity:29/98 - (29%)
Similarity:43/98 - (43%) Gaps:14/98 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 NARERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYILMQQNALEELRRLLAYIQS 198
            |.|||.|:..:|.....||..:|  :..:.:|:||:.||..|..||...|..|:|...:.|.:|.
Zfish    72 NERERNRVKQVNMGFQTLRQHVP--NGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAVLQC 134

  Fly   199 TTGAAPLDLGAFPAAAKLQALLQGPHNEPPTSS 231
                      ..|:.:...|...||  |.|.|:
Zfish   135 ----------GVPSPSVSNAYSAGP--ESPHSA 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_523592.1 bHLH_TS_bHLHe22_bHLHb5 129..198 CDD:381524 21/63 (33%)
ascl1bNP_571306.1 bHLH_SF 63..133 CDD:469605 21/62 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..164 6/17 (35%)

Return to query results.
Submit another query.