DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and Olig2

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001094027.1 Gene:Olig2 / 304103 RGDID:1307098 Length:323 Species:Rattus norvegicus


Alignment Length:223 Identity:85/223 - (38%)
Similarity:120/223 - (53%) Gaps:31/223 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PTASPPQS--VPGRRTPLGSVGLGGFYAQGMGMSQQPPTDENKPGPSAPEKPLSPTAAAIAAIAI 97
            |::..|..  :|.|.....|.|.     .|..:|...|:| ..|..|:..:....||.|.....:
  Rat    12 PSSPEPDDLFLPARSKGGSSSGF-----TGGTVSSSTPSD-CPPELSSELRGAMGTAGAHPGDKL 70

  Fly    98 SGG---TTTVAVSSGGASGSGSNSGKQKNR----QGKTVRLNINARERRRMHDLNDALDELRSVI 155
            .||   :::.:.||..:|.:.|::.|.|.:    :.:.:||.||:|||:||||||.|:|.||.|:
  Rat    71 GGGGFKSSSSSTSSSTSSAATSSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVM 135

  Fly   156 PYAHSPSVRKLSKIATLLLAKNYILMQQNALEELRRLLAYI---------QSTTG----AAPLDL 207
            ||||.|||||||||||||||:|||||..|:|||::||::.|         .|..|    :.||..
  Rat   136 PYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSTPLPT 200

  Fly   208 G-AFPAAAKLQALLQGPHNE--PPTSSS 232
            . |.||||...|.....|:.  ||.:::
  Rat   201 ATAHPAAAAHAAHHPAVHHPILPPAAAA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 41/53 (77%)
Olig2NP_001094027.1 bHLH_TS_OLIG2 95..179 CDD:381510 51/83 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.