DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and atoh1a

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_571166.2 Gene:atoh1a / 30303 ZFINID:ZDB-GENE-990415-17 Length:292 Species:Danio rerio


Alignment Length:158 Identity:54/158 - (34%)
Similarity:71/158 - (44%) Gaps:36/158 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GMGMSQQPPTDENKPGPSAPEKPLSPTAAAIAA-----IAISGGTTTVAVSSGG----ASGS--- 114
            |.|...:.|........|.|...|:|..|...|     :..|.|::...|||..    :|.|   
Zfish    22 GRGEQSEYPPALALMASSDPRAWLAPVQAGTCAAHAEYLLHSPGSSAEGVSSASNFRKSSKSPVK 86

  Fly   115 -----------GSNSGKQKNRQGKTV-------RLNINARERRRMHDLNDALDELRSVIPYAHSP 161
                       |::.|:|:....|:.       |:..|||||||||.||.|.||||||||...:.
Zfish    87 VRELCRLKGAVGADEGRQRAPSSKSTNVVQKQRRMAANARERRRMHGLNHAFDELRSVIPAFDND 151

  Fly   162 SVRKLSKIATLLLAKNYILMQQNALEEL 189
              :||||..||.:|:.||    |||.:|
Zfish   152 --KKLSKYETLQMAQIYI----NALSDL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 32/53 (60%)
atoh1aNP_571166.2 HLH 117..175 CDD:238036 34/63 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.