DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and Neurog2

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_008759703.1 Gene:Neurog2 / 295475 RGDID:1309061 Length:263 Species:Rattus norvegicus


Alignment Length:231 Identity:67/231 - (29%)
Similarity:83/231 - (35%) Gaps:65/231 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MLGGQHPAPTASPPQSVPGRRTPLGSVGLGGFYAQGMGMSQQPPTDE--NKPGPSAPEKPLSPTA 89
            :||...||.....|                      |..|.....||  .:||.:..::      
  Rat    19 LLGSASPASATLTP----------------------MSSSADEEEDEELRRPGAARGQR------ 55

  Fly    90 AAIAAIAISGGTTTVAVSSGG---------------------ASGSGSNSGKQKNRQGKTVRLNI 133
            .|.|...:.|.:   |..:||                     |...|:.:.:...|..||.||..
  Rat    56 GAEAGQGVQGSS---ASGAGGCRPGRLLGLVHECKRRPSRARAVSRGAKTAETVQRIKKTRRLKA 117

  Fly   134 NARERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYILMQQNALEELRRLLAYIQS 198
            |.|||.|||:||.|||.||.|:|  ..|...||:||.||..|.|||.    ||.|..||..:   
  Rat   118 NNRERNRMHNLNAALDALREVLP--TFPEDAKLTKIETLRFAHNYIW----ALTETLRLADH--- 173

  Fly   199 TTGAAPLDLGAFPAAAKLQ--ALLQGPHNEPPTSSS 232
            ..|...|....|..|..|.  |.|....:.|..|||
  Rat   174 CAGGGSLQGALFSEAVLLSPGAALGASGDSPSPSSS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 29/53 (55%)
Neurog2XP_008759703.1 HLH 110..169 CDD:238036 34/64 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339092
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.