DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and Neurod4

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001099412.2 Gene:Neurod4 / 288821 RGDID:1310434 Length:330 Species:Rattus norvegicus


Alignment Length:187 Identity:56/187 - (29%)
Similarity:75/187 - (40%) Gaps:54/187 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RTPLGSVGLGGFYAQ---GMGMSQQPPTDENKPGPSAPEKPLSPTAAAIAAIAISGGTTTVAVSS 108
            |.| ||.|:.|...:   .:...::...|.:||....|:|                         
  Rat    36 RRP-GSYGMLGTLMEEHDSIEEEEEEEEDGDKPKRRGPKK------------------------- 74

  Fly   109 GGASGSGSNSGKQKNRQGKTVRLNINARERRRMHDLNDALDELRSVIP-YAHSPSVRKLSKIATL 172
                   ....|.:..:.:..|:..|||||.|||.||||||.||.|:| |:   ..:|||||.||
  Rat    75 -------KKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYS---KTQKLSKIETL 129

  Fly   173 LLAKNYILMQQNALEELRRL------------LAYIQSTTGAAPLDLGAFPAAAKLQ 217
            .||:|||......||..:.|            |:...|...|..|.||  |.:|.|:
  Rat   130 RLARNYIWALSEVLETGQTLEGKGFVEMLCKGLSQPTSNLVAGCLQLG--PQSALLE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 32/54 (59%)
Neurod4NP_001099412.2 bHLH_TS_NeuroD4_ATOH3 59..145 CDD:381564 39/120 (33%)
Neuro_bHLH 146..263 CDD:403655 10/41 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.