DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and BHLHE22

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_689627.1 Gene:BHLHE22 / 27319 HGNCID:11963 Length:381 Species:Homo sapiens


Alignment Length:324 Identity:119/324 - (36%)
Similarity:147/324 - (45%) Gaps:108/324 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PGL-----PNHGHMPIPPTANMLGGQHPA-PTAS----PPQ------------------SVPGRR 47
            ||:     |.....|...:::.||...|| |..:    ||.                  .|||  
Human    40 PGMDLSLAPPPRERPASSSSSPLGCFEPADPEGAGLLLPPPGGGGGGSAGSGGGGGGGVGVPG-- 102

  Fly    48 TPLGSVGLG------------------------GFYAQGMGMSQQPPTDEN-------KPGPSAP 81
            ..:||.|:|                        |..|:..|..|.|..|.:       :.|.:.|
Human   103 LLVGSAGVGGDPSLSSLPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADP 167

  Fly    82 EKPLSPTAAAIAAIAI---------------------SGGTTTVAVSSGGASGSGSNSG------ 119
            .  .||.|....|.|.                     .||..:.:.||||..||||.||      
Human   168 R--ASPGAGGGGAKAAEGCSNAHLHGGASVPPGGLGGGGGGGSSSGSSGGGGGSGSGSGGSSSSS 230

  Fly   120 ---KQKNRQGKTVRLNINARERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYILM 181
               .:|:::.|.:|||||||||||||||||||||||:||||||||||||||||||||||||||||
Human   231 SSSSKKSKEQKALRLNINARERRRMHDLNDALDELRAVIPYAHSPSVRKLSKIATLLLAKNYILM 295

  Fly   182 QQNALEELRRLLAYI---QSTTGAA-PLDLGAFPAAAKLQALLQGPHNE----------PPTSS 231
            |..||||:|||:||:   |:.:.|: |....|..|||.|...| |.:.:          ||.:|
Human   296 QAQALEEMRRLVAYLNQGQAISAASLPSSAAAAAAAAALHPAL-GAYEQAAGYPFSAGLPPAAS 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 50/53 (94%)
BHLHE22NP_689627.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..94 11/53 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..154 6/18 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..242 13/53 (25%)
HLH 248..302 CDD:197674 50/53 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6879
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4633
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1617813at2759
OrthoFinder 1 1.000 - - FOG0002346
OrthoInspector 1 1.000 - - otm41513
orthoMCL 1 0.900 - - OOG6_106693
Panther 1 1.100 - - LDO PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5479
SonicParanoid 1 1.000 - - X1548
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.