powered by:
Protein Alignment Oli and neurod4
DIOPT Version :9
Sequence 1: | NP_001188830.1 |
Gene: | Oli / 35066 |
FlyBaseID: | FBgn0032651 |
Length: | 232 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_739568.2 |
Gene: | neurod4 / 266958 |
ZFINID: | ZDB-GENE-030730-1 |
Length: | 348 |
Species: | Danio rerio |
Alignment Length: | 69 |
Identity: | 35/69 - (50%) |
Similarity: | 43/69 - (62%) |
Gaps: | 4/69 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 120 KQKNRQGKTVRLNINARERRRMHDLNDALDELRSVIP-YAHSPSVRKLSKIATLLLAKNYILMQQ 183
|.:..:.:..|:..|||||.|||.||||||.||.|:| |: ..:|||||.||.||:|||....
Zfish 89 KARQERFRARRIKANARERSRMHGLNDALDNLRRVMPCYS---KTQKLSKIETLRLARNYIWALS 150
Fly 184 NALE 187
..||
Zfish 151 EVLE 154
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Oli | NP_001188830.1 |
HLH |
134..188 |
CDD:197674 |
33/55 (60%) |
neurod4 | NP_739568.2 |
HLH |
98..154 |
CDD:238036 |
32/58 (55%) |
Neuro_bHLH |
156..272 |
CDD:289310 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3898 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.