DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and Bhlha15

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_036995.1 Gene:Bhlha15 / 25334 RGDID:3091 Length:197 Species:Rattus norvegicus


Alignment Length:191 Identity:60/191 - (31%)
Similarity:80/191 - (41%) Gaps:49/191 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PGRRTPLGSVGLGGFYAQGMGMSQQPPTDENKPGPSAPEKPLSPTAAAIAAIAISGGTTTVAVSS 108
            |.||||:...                   |..||...|::..|.:.|:         ..|..:.|
  Rat     8 PRRRTPMQDA-------------------EATPGEQTPDRSQSGSGAS---------EVTKGLRS 44

  Fly   109 GGASGSGSNSGKQKNRQGKTV--------RLNINARERRRMHDLNDALDELRSVIPYAHSPSVRK 165
            ..|..||:.:...:.|||.:.        ||..|.|||:|||.||:|...||.|||  |..:.:|
  Rat    45 RTARASGTRAEVSRRRQGSSSRRENSVQRRLESNERERQRMHKLNNAFQALREVIP--HVRADKK 107

  Fly   166 LSKIATLLLAKNYILMQQNALEELRRLLAYIQSTTGAAPLDLGAFPAAAKLQALLQGPHNE 226
            ||||.||.||||||          :.|.|.|.:.:.:....|.| |..|....|.|..|::
  Rat   108 LSKIETLTLAKNYI----------KSLTATILTMSSSRLPGLEA-PGPAPGPKLYQHYHHQ 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 29/53 (55%)
Bhlha15NP_036995.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..82 23/101 (23%)
HLH 70..124 CDD:238036 31/65 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..197
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.