DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and Twist1

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_035788.1 Gene:Twist1 / 22160 MGIID:98872 Length:206 Species:Mus musculus


Alignment Length:194 Identity:57/194 - (29%)
Similarity:79/194 - (40%) Gaps:37/194 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PIPPTANMLGGQHPAPTASPPQS--------VPGRRTPLGSVGLGGFYAQGMGMSQQPPTD-ENK 75
            |:.|..:.|......|....|.|        ...||:..||.|.||....|:|...:|.:. :.|
Mouse     9 PVSPADDSLSNSEEEPDRQQPASGKRGARKRRSSRRSAGGSAGPGGATGGGIGGGDEPGSPAQGK 73

  Fly    76 PGPSAPEKPLSPTAAAIAAIAISGGTTTVAVSSGGASGSGSNSG---KQKNRQGKTVRLNINARE 137
            .|..:                 :||........||..|.||:||   .|...:.:|.|:..|.||
Mouse    74 RGKKS-----------------AGGGGGGGAGGGGGGGGGSSSGGGSPQSYEELQTQRVMANVRE 121

  Fly   138 RRRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYI-----LMQQNALEELRRLLAYI 196
            |:|...||:|...||.:||...|.   |||||.||.||..||     ::|.:.|:......:|:
Mouse   122 RQRTQSLNEAFAALRKIIPTLPSD---KLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYV 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 26/58 (45%)
Twist1NP_035788.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..109 28/116 (24%)
HLH 113..163 CDD:306515 25/52 (48%)
Sufficient for transactivation activity 165..195 3/18 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.