DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and hlh-17

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_502928.3 Gene:hlh-17 / 185460 WormBaseID:WBGene00001961 Length:101 Species:Caenorhabditis elegans


Alignment Length:69 Identity:49/69 - (71%)
Similarity:60/69 - (86%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 VRLNINARERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYILMQQNALEELRRLL 193
            |||:||.|||.||||||:|||:||:||||||..||||||||||||||||:|:||..|:|||..|:
 Worm    15 VRLSINLRERCRMHDLNEALDDLRAVIPYAHGGSVRKLSKIATLLLAKNHIIMQAKAIEELSILV 79

  Fly   194 AYIQ 197
            :.::
 Worm    80 SQLK 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 41/53 (77%)
hlh-17NP_502928.3 bHLH_TS_bHLHe22_like 16..76 CDD:381474 46/59 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159976
Domainoid 1 1.000 82 1.000 Domainoid score I5386
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1617813at2759
OrthoFinder 1 1.000 - - FOG0002346
OrthoInspector 1 1.000 - - otm14298
orthoMCL 1 0.900 - - OOG6_106693
Panther 1 1.100 - - LDO PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5479
SonicParanoid 1 1.000 - - X1548
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.