DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and Neurog1

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_035026.1 Gene:Neurog1 / 18014 MGIID:107754 Length:244 Species:Mus musculus


Alignment Length:203 Identity:60/203 - (29%)
Similarity:84/203 - (41%) Gaps:60/203 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 TDENKPGPSAPEKPLSPTA-----AAIAAIAISGGTTTVAVSSGGASGSGSNSGKQKNRQG---- 126
            |||.   ..|..:||:.|:     |..:|.|:||        :....|:.....:::.|:|    
Mouse    28 TDEE---DCARLQPLASTSGLSVPARRSAPALSG--------ASNVPGAQDEEQERRRRRGRARV 81

  Fly   127 ----------KTVRLNINARERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYILM 181
                      ::.|:..|.|||.|||:||.|||.||||:|  ..|...||:||.||..|.|||. 
Mouse    82 RSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLP--SFPDDTKLTKIETLRFAYNYIW- 143

  Fly   182 QQNALEELRRLLAYIQSTTGAA-------PLDLGAFP---------------AAAKLQALLQGPH 224
               ||.|..||..  |...|.:       |..:...|               |||...|.:..|.
Mouse   144 ---ALAETLRLAD--QGLPGGSARERLLPPQCVPCLPGPPSPASDTESWGSGAAASPCATVASPL 203

  Fly   225 NEPPTSSS 232
            ::|.:.|:
Mouse   204 SDPSSPSA 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 30/53 (57%)
Neurog1NP_035026.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..82 10/50 (20%)
HLH 91..150 CDD:238036 32/64 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835471
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.