DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and Neurod1

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_035024.1 Gene:Neurod1 / 18012 MGIID:1339708 Length:357 Species:Mus musculus


Alignment Length:112 Identity:48/112 - (42%)
Similarity:63/112 - (56%) Gaps:23/112 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KQKNRQGKTVRLNINARERRRMHDLNDALDELRSVIP-YAHSPSVRKLSKIATLLLAKNYILMQQ 183
            |.:..:.|..|:..|||||.|||.||.|||.||.|:| |:   ..:|||||.||.||||||.   
Mouse    93 KARLERFKLRRMKANARERNRMHGLNAALDNLRKVVPCYS---KTQKLSKIETLRLAKNYIW--- 151

  Fly   184 NALEELRRLLAYIQSTTGAAPLDLGAFPAAAKLQALLQGPHNEPPTS 230
             ||.|:.|        :|.:| ||.:|     :|.|.:| .::|.|:
Mouse   152 -ALSEILR--------SGKSP-DLVSF-----VQTLCKG-LSQPTTN 182

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 33/54 (61%)