DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and Neurog2

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_033848.1 Gene:Neurog2 / 11924 MGIID:109619 Length:263 Species:Mus musculus


Alignment Length:232 Identity:71/232 - (30%)
Similarity:85/232 - (36%) Gaps:65/232 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MLGGQHPA-PTASP---------------PQSVPGRRTPLGSVGLGGFYAQGMGMSQQPPTDENK 75
            :||...|| .|.:|               |.|..|:|......|:.|..|.|.|..        :
Mouse    19 LLGSASPASATLTPMSSSADEEEDEELRRPGSARGQRGAEAGQGVQGSPASGAGGC--------R 75

  Fly    76 PG------PSAPEKPLSPTAAAIAAIAISGGTTTVAVSSGGASGSGSNSGKQKNRQGKTVRLNIN 134
            ||      .....:|                      |...|...|:.:.:...|..||.||..|
Mouse    76 PGRLLGLMHECKRRP----------------------SRSRAVSRGAKTAETVQRIKKTRRLKAN 118

  Fly   135 ARERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYILMQQNALEELRRLLAYIQST 199
            .|||.|||:||.|||.||.|:|  ..|...||:||.||..|.|||.    ||.|..||..:   .
Mouse   119 NRERNRMHNLNAALDALREVLP--TFPEDAKLTKIETLRFAHNYIW----ALTETLRLADH---C 174

  Fly   200 TGAAPLDLGAFPAAAKLQ---AL-LQGPHNEPPTSSS 232
            .||..|....|..|..|.   || ..|....||:|.|
Mouse   175 AGAGGLQGALFTEAVLLSPGAALGASGDSPSPPSSWS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 29/53 (55%)
Neurog2NP_033848.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..76 15/63 (24%)
bHLH_TS_NGN2_ATOH4 104..172 CDD:381560 37/73 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..253 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835467
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.