Sequence 1: | NP_001188830.1 | Gene: | Oli / 35066 | FlyBaseID: | FBgn0032651 | Length: | 232 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_031526.1 | Gene: | Atoh1 / 11921 | MGIID: | 104654 | Length: | 351 | Species: | Mus musculus |
Alignment Length: | 242 | Identity: | 70/242 - (28%) |
---|---|---|---|
Similarity: | 89/242 - (36%) | Gaps: | 76/242 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 QHPAP------TASPPQSVPGRRTPLGSVGLG----------------G----------FYAQGM 63
Fly 64 GMSQ-QPPTDE--------NKPGPSAPEKPLSPTAAAIAAIAISGGTTTVAVSSGGASGSGSNSG 119
Fly 120 KQKNRQGKTVRLNINARERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYILMQQN 184
Fly 185 ALEELRRLLAYIQSTTGAAPLDLGAFPAAAKLQALLQGPHNEPPTSS 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Oli | NP_001188830.1 | HLH | 134..188 | CDD:197674 | 30/53 (57%) |
Atoh1 | NP_031526.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 16..39 | 6/17 (35%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 89..116 | 5/26 (19%) | |||
HLH | 155..213 | CDD:238036 | 35/89 (39%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 244..278 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 308..351 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |