DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and OLIG1

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_620450.2 Gene:OLIG1 / 116448 HGNCID:16983 Length:271 Species:Homo sapiens


Alignment Length:194 Identity:76/194 - (39%)
Similarity:97/194 - (50%) Gaps:28/194 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SVPG---RRTPLGSVGLGGFYAQGMGMSQQPPTDENKPGPSAPEKPLSPTAAAIAAIAISGGTTT 103
            :|||   |....|.:.||....:.:|. :|||:..:....|......|.|.|.:...|.......
Human    12 AVPGTMLRPQRPGDLQLGASLYELVGY-RQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEA 75

  Fly   104 VAVSSGGASGSGSNSG-----KQKNRQGKTVRLNINARERRRMHDLNDALDELRSVI-PY--AHS 160
            .|...|...|||::.|     ..|..|.:.:|..||:|||:||.|||.|:|.||.|| ||  ||.
Human    76 PAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHC 140

  Fly   161 PSV--RKLSKIATLLLAKNYILMQQNALEELRRLLAYIQSTTGAAPLDLGAFPAAAKLQALLQG 222
            ...  ||||||||||||:||||:..::|:||||.|..            ||.|||.:|  ||.|
Human   141 QGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGE------------GAGPAAPRL--LLAG 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 36/58 (62%)
OLIG1NP_620450.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..117 22/79 (28%)
HLH 107..164 CDD:278439 37/56 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.