DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and atoh1c

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_003199618.1 Gene:atoh1c / 100498672 ZFINID:ZDB-GENE-090805-1 Length:204 Species:Danio rerio


Alignment Length:115 Identity:44/115 - (38%)
Similarity:56/115 - (48%) Gaps:14/115 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PSAP----EKPLSPTAAAIAAIAISGGTTTVAVSSGGASGSGSNSGKQKNRQGKTVRLNINARER 138
            |.||    |:.|...|:......:....|.::.|    |...|:..:.:.|:    ||..|||||
Zfish    25 PKAPMGWREEQLQDRASCDPCALVQLRLTGLSYS----SEEQSSIARARRRR----RLAANARER 81

  Fly   139 RRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYILMQQNALEE 188
            |||..||.|.|.||||||...|.  |||||..||.:|:.||......||:
Zfish    82 RRMLGLNVAFDRLRSVIPNVESD--RKLSKSETLQMAQIYISTLSELLED 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 30/53 (57%)
atoh1cXP_003199618.1 HLH 87..129 CDD:197674 22/43 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.