DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and neurog2

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_002934289.2 Gene:neurog2 / 100493110 XenbaseID:XB-GENE-491040 Length:213 Species:Xenopus tropicalis


Alignment Length:136 Identity:46/136 - (33%)
Similarity:64/136 - (47%) Gaps:23/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 SAPEKPLSPTAAAIAAIAISGGTTTVAVSSGGASGSGSNSGKQKNRQGKTV-------RLNINAR 136
            |..|:.||||:.|:..:.          :....:...|...:.:.:.|:||       |:..|.|
 Frog    36 SDDEQLLSPTSPALMHLQ----------AQEQENSPPSRRSRPRTKNGETVLKVKKTRRIKANNR 90

  Fly   137 ERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYILMQQNALEELRRLLAYIQSTTG 201
            ||.|||.||.|||.||.|:|  ..|...||:||.||..|.|||.    ||.|..||..:..|.:.
 Frog    91 ERNRMHHLNSALDSLREVLP--SLPEDAKLTKIETLRFAYNYIW----ALSETLRLAEHGSSAST 149

  Fly   202 AAPLDL 207
            .:|:.:
 Frog   150 LSPMSV 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 29/53 (55%)
neurog2XP_002934289.2 bHLH_TS_NGN2_ATOH4 74..142 CDD:381560 35/73 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.