DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and bhlha15

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_017952828.2 Gene:bhlha15 / 100485413 XenbaseID:XB-GENE-877127 Length:175 Species:Xenopus tropicalis


Alignment Length:112 Identity:47/112 - (41%)
Similarity:56/112 - (50%) Gaps:17/112 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KQKNRQGK---TVRLNINARERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYILM 181
            |::...||   |.||..|.|||:|||.||:|...||.|||  |..:.:|||||.||.||||||  
 Frog    55 KRETANGKEHSTRRLESNERERQRMHKLNNAFQALREVIP--HVRAEKKLSKIETLTLAKNYI-- 115

  Fly   182 QQNALEELRRLLAYI--QSTTGAAPLDLGAFPAAAKLQALLQGPHNE 226
                    ..|.|.|  .|:..|||...|......||....|..|::
 Frog   116 --------NTLTATILNMSSGCAAPGQEGRPANGGKLFQHYQQQHSD 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 29/53 (55%)
bhlha15XP_017952828.2 bHLH_SF 67..128 CDD:412148 35/72 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.