DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and si:ch211-196c10.13

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_002663164.1 Gene:si:ch211-196c10.13 / 100334878 ZFINID:ZDB-GENE-130603-71 Length:175 Species:Danio rerio


Alignment Length:158 Identity:66/158 - (41%)
Similarity:88/158 - (55%) Gaps:14/158 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RRTPLGSVGLGGFYAQGMGMSQQPPTDENKPGPSAPEKPLS--PTAAAIAAIAISGGTTTVAVS- 107
            :..|:..||...||. .||.:        :.|...|..|..  .|:..|..:..|..|...:.. 
Zfish    15 KMNPMAVVGDPRFYT-SMGCA--------RLGEGDPAHPFDNFTTSHQIIDVTTSAETDRKSFQG 70

  Fly   108 -SGGASGSGSNSGKQKNRQGKTVRLNINARERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIAT 171
             ..|..|:..:|.:.....| .:||.|||||||||||||:|||:||:||||..:..|:|||||||
Zfish    71 LESGCHGNSVSSSRTVKEPG-ALRLLINARERRRMHDLNEALDDLRAVIPYTSNRKVKKLSKIAT 134

  Fly   172 LLLAKNYILMQQNALEELRRLLAYIQST 199
            ||||||:||||..||:|:||::..:..|
Zfish   135 LLLAKNHILMQARALKEMRRIVEQMDVT 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 41/53 (77%)
si:ch211-196c10.13XP_002663164.1 HLH 97..151 CDD:197674 41/53 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1617813at2759
OrthoFinder 1 1.000 - - FOG0002346
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1548
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.