DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and olig1

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001018632.1 Gene:olig1 / 100001484 ZFINID:ZDB-GENE-050107-2 Length:235 Species:Danio rerio


Alignment Length:181 Identity:60/181 - (33%)
Similarity:84/181 - (46%) Gaps:58/181 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 GASGSGSNSG-------------KQKNRQGKTVRLNINARERRRMHDLNDALDELRSV-IPYAHS 160
            |:.|.|||.|             :..:.:.:.:|..||:|||:||.|||.|:|.||.| :||:.|
Zfish    29 GSGGPGSNVGSLQGPLRSSKPPRELSSEEQQELRRKINSRERKRMQDLNVAMDALREVMVPYSSS 93

  Fly   161 P------------------SVRKLSKIATLLLAKNYILMQQNALEELRRLLAYI---QSTTGAAP 204
            |                  :.|:||||:||:||:||||:..::|:|:||||..:   ...:|..|
Zfish    94 PTGVGGALQHPYFPPGAPTTGRRLSKISTLVLARNYILLLGSSLQEMRRLLGEVSIGMGVSGTVP 158

  Fly   205 --LDLGAFP-----------------AAAKLQALLQGPHNEP----PTSSS 232
              |..|.:|                 ..||...|.||...||    |.|.|
Zfish   159 RLLLTGGWPFLTGPGQLLLSPPEQQLGVAKCPLLPQGAQEEPLAWGPGSMS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 32/72 (44%)
olig1NP_001018632.1 HLH domain 62..139 34/76 (45%)
HLH 62..133 CDD:278439 33/70 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.