DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and Csnk1a1

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_006526446.1 Gene:Csnk1a1 / 93687 MGIID:1934950 Length:374 Species:Mus musculus


Alignment Length:368 Identity:199/368 - (54%)
Similarity:257/368 - (69%) Gaps:32/368 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KLLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFP 84
            :.::||||:||:.|||||||||||.::||:|.|||:|:|...|::|||:||:|:|:.|....|.|
Mouse    10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIP 74

  Fly    85 TLLHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKP 149
            .:..||.||:||.:||||||||||:|||.|.|||::||||||.||::.|||.||.:.||||||||
Mouse    75 HIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKP 139

  Fly   150 DNFLMGLDRHCNK----------------------------LYLIDFGLSKRYKDIESEIHIPYR 186
            ||||||:.|||||                            |:||||||:|:|:|..:..|||||
Mouse   140 DNFLMGIGRHCNKCLESPVGKRKRSMTVSPSQDPSFSGLNQLFLIDFGLAKKYRDNRTRQHIPYR 204

  Fly   187 TDRNLTGTVRYASINAQIGVEQSRRDDMESMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKT 251
            .|:|||||.|||||||.:|:||||||||||:.|.|||||...|||||:.||.||||||||.|||.
Mouse   205 EDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKM 269

  Fly   252 SVTIAQLCKGFPSEFCLLMTYVRNLGFKEPPDHTYLRQIFRILFRSLNHHYDYIYDWTALQQQKD 316
            |..:..||||||:||.:.:.|.|.|.|:|.||:.||||:||||||:|||.|||.:|||.|:|:..
Mouse   270 STPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA 334

  Fly   317 QICRSREQILESEREEVRKRDGERGCEPQRDKERHKDLELDRL 359
            |...|.    ..:.::.:...|::..:.:.:.:..||.:||.|
Mouse   335 QQAASS----SGQGQQAQTPTGKQTDKTKSNMKGIKDEKLDPL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 172/292 (59%)
SPS1 26..>266 CDD:223589 159/267 (60%)
Csnk1a1XP_006526446.1 STKc_CK1_alpha 16..309 CDD:271030 172/292 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849719
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S180
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.670

Return to query results.
Submit another query.