DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and YCK3

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_011049.2 Gene:YCK3 / 856860 SGDID:S000000925 Length:524 Species:Saccharomyces cerevisiae


Alignment Length:424 Identity:144/424 - (33%)
Similarity:207/424 - (48%) Gaps:62/424 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RNASLHLEKLLIGGKYRLVKPIGSGSFGDIYLGLSI------TDGSE-----------VAIKVEK 59
            :.:|.|    ::|..|.:...||.||||.|:.|.:|      ..||:           ||||.|.
Yeast     3 QRSSQH----IVGIHYAVGPKIGEGSFGVIFEGENILHSCQAQTGSKRDSSIIMANEPVAIKFEP 63

  Fly    60 NDAKYPQLIYEAKVYEQLARCPGFPTLLHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVL 124
            ..:..|||..|.:.|..|..|.|.|...::|.|..:|.:::||||||||:||..|.|:||:||..
Yeast    64 RHSDAPQLRDEFRAYRILNGCVGIPHAYYFGQEGMHNILIIDLLGPSLEDLFEWCGRKFSVKTTC 128

  Fly   125 MLTDQLLMRIECVHERGFIHRDIKPDNFLMG----------LDRHC--------NKLYLIDFGLS 171
            |:..|::.|:..:|:...|:|||||||||:.          :.:.|        |.:|::|||::
Yeast   129 MVAKQMIDRVRAIHDHDLIYRDIKPDNFLISQYQRISPEGKVIKSCASSSNNDPNLIYMVDFGMA 193

  Fly   172 KRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDMESMSYCLMYFNLGKLPWQGITA 236
            |:|:|..::.|||||..::|:||.||.|||...|.|||||||:||:.:...||..|.|||||:.|
Yeast   194 KQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKA 258

  Fly   237 ANKKQKYEKI--LEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFKEPPDHTYLRQIFRILFRSLN 299
            .|.|.|||||  .::|.:.....|....|.:|...:.|.|:|.|.|.||:.||..:.....|..:
Yeast   259 PNNKLKYEKIGMTKQKLNPDDLLLNNAIPYQFATYLKYARSLKFDEDPDYDYLISLMDDALRLND 323

  Fly   300 HHYDYIYDWTALQQQKD-QICRSREQIL------------ESEREEVRKRDGERGCEP------Q 345
            ...|..|||..|...|. .|..:|...|            .:.|..|......|...|      |
Yeast   324 LKDDGHYDWMDLNGGKGWNIKINRRANLHGYGNPNPRVNGNTARNNVNTNSKTRNTTPVATPKQQ 388

  Fly   346 RDKERHKDLELDRLHKTSTQQAKCSNGHLTNRYD 379
            .....:||....|:  :|..|:.....|:..:.:
Yeast   389 AQNSYNKDNSKSRI--SSNPQSFTKQQHVLKKIE 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 120/301 (40%)
SPS1 26..>266 CDD:223589 110/276 (40%)
YCK3NP_011049.2 PKc_like 13..320 CDD:419665 120/306 (39%)
ROM1 361..>479 CDD:227709 11/62 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344358
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.