DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and CKL2

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_177415.1 Gene:CKL2 / 843603 AraportID:AT1G72710 Length:465 Species:Arabidopsis thaliana


Alignment Length:296 Identity:169/296 - (57%)
Similarity:221/296 - (74%) Gaps:1/296 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFPTLL 87
            :|.|:||.:.||.||||:||||.:|....|||||:|....|:|||:||:|:|:.|....|.|.:.
plant     5 VGNKFRLGRKIGGGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQGGTGVPNVK 69

  Fly    88 HYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKPDNF 152
            .||.|.:||.:|:||||||||:|||.|.|:.||||||||.||::.|||.||::.|:|||||||||
plant    70 WYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVHQKSFLHRDIKPDNF 134

  Fly   153 LMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDMESM 217
            ||||.|..|::|:|||||:|:|:|...: |||||.::|||||.||||:|..:|:|||||||:||:
plant   135 LMGLGRRANQVYVIDFGLAKKYRDSNHQ-HIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESL 198

  Fly   218 SYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFKEPP 282
            .:.||||..|.|||||:.|.|||||||||.|||.|.:|..||:|:||||.....|.|:|.|.:.|
plant   199 GFVLMYFLKGSLPWQGLKAGNKKQKYEKISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKP 263

  Fly   283 DHTYLRQIFRILFRSLNHHYDYIYDWTALQQQKDQI 318
            |:.||:::||.||......:||::|||.|:.|:.||
plant   264 DYAYLKRLFRDLFIREGFQFDYVFDWTILKYQQSQI 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 155/264 (59%)
SPS1 26..>266 CDD:223589 145/239 (61%)
CKL2NP_177415.1 STKc_CK1_delta_epsilon 8..281 CDD:271027 159/273 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.690

Return to query results.
Submit another query.