DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and CKL13

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_171939.1 Gene:CKL13 / 839520 AraportID:AT1G04440 Length:468 Species:Arabidopsis thaliana


Alignment Length:291 Identity:160/291 - (54%)
Similarity:220/291 - (75%) Gaps:0/291 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFPTL 86
            ::|||::|.:.:||||||:|:||:::..|.|||:|:|...|::|||.||:|:|..|....|.|.|
plant     4 VVGGKFKLGRKLGSGSFGEIFLGVNVQTGEEVAVKLEPLRARHPQLHYESKLYMLLQGGTGIPHL 68

  Fly    87 LHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKPDN 151
            ..:|.|..:|.||:||||||:||.||.|.|.|||||||||.||::.|:|.:|.:||:||||||||
plant    69 KWFGVEGEFNCMVIDLLGPSMEEFFNYCSRSFSLKTVLMLADQMINRVEYMHVKGFLHRDIKPDN 133

  Fly   152 FLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDMES 216
            |||||.|..|::|:||:||:|:|:|:::..|||||.::|||||.||||:|..:|:|||||||:||
plant   134 FLMGLGRKANQVYIIDYGLAKKYRDLQTHKHIPYRENKNLTGTARYASVNTHLGIEQSRRDDLES 198

  Fly   217 MSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFKEP 281
            :.|.||||..|.|||||:.|..|||||:||.|||....:..|||.||.||.....|||:|.|::.
plant   199 LGYLLMYFLRGSLPWQGLRAGTKKQKYDKISEKKRLTPVEVLCKNFPPEFTSYFLYVRSLRFEDK 263

  Fly   282 PDHTYLRQIFRILFRSLNHHYDYIYDWTALQ 312
            ||::||:::||.||....:.:||::|||.|:
plant   264 PDYSYLKRLFRDLFIREGYQFDYVFDWTILR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 148/264 (56%)
SPS1 26..>266 CDD:223589 137/239 (57%)
CKL13NP_171939.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 152/273 (56%)
Pkinase 9..241 CDD:278497 131/231 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.690

Return to query results.
Submit another query.