DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and ADK1

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_563695.2 Gene:ADK1 / 839368 AraportID:AT1G03930 Length:471 Species:Arabidopsis thaliana


Alignment Length:292 Identity:167/292 - (57%)
Similarity:220/292 - (75%) Gaps:0/292 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFPT 85
            |:||||::|.:.|||||||::|||:::..|.|||:|:|....|:|||.||:|:|..|....|.|.
plant     3 LVIGGKFKLGRKIGSGSFGELYLGINVQTGEEVAVKLESVKTKHPQLHYESKLYMLLQGGTGVPN 67

  Fly    86 LLHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKPD 150
            |..||.|.:||.||:||||||||:|||.|.|:.||||||||.|||:.|:|.:|.|||:|||||||
plant    68 LKWYGVEGDYNVMVIDLLGPSLEDLFNYCNRKLSLKTVLMLADQLINRVEFMHTRGFLHRDIKPD 132

  Fly   151 NFLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDME 215
            ||||||.|..|::|:|||||.|:|:|:::..|||||.::|||||.||||:|..:|||||||||:|
plant   133 NFLMGLGRKANQVYIIDFGLGKKYRDLQTHRHIPYRENKNLTGTARYASVNTHLGVEQSRRDDLE 197

  Fly   216 SMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFKE 280
            ::.|.||||..|.|||||:.|..|||||::|.|||.:..|..|||..||||.....|.|:|.|.:
plant   198 ALGYVLMYFLKGSLPWQGLKAGTKKQKYDRISEKKVATPIEVLCKNQPSEFVSYFRYCRSLRFDD 262

  Fly   281 PPDHTYLRQIFRILFRSLNHHYDYIYDWTALQ 312
            .||::||:::||.||....:.:||::|||.|:
plant   263 KPDYSYLKRLFRDLFIREGYQFDYVFDWTVLK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 153/264 (58%)
SPS1 26..>266 CDD:223589 143/239 (60%)
ADK1NP_563695.2 STKc_CK1_delta_epsilon 8..282 CDD:271027 157/273 (58%)
SPS1 8..>277 CDD:223589 155/268 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.