DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and ckl7

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001330873.1 Gene:ckl7 / 834433 AraportID:AT5G44100 Length:476 Species:Arabidopsis thaliana


Alignment Length:397 Identity:186/397 - (46%)
Similarity:249/397 - (62%) Gaps:53/397 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFPT 85
            |:||||::|.|.|||||||::|||:::..|.|||:|:|....|:|||.||:|:|..|....|.|.
plant     3 LVIGGKFKLGKKIGSGSFGELYLGVNVQTGEEVAVKLENVKTKHPQLHYESKLYMLLQGGSGIPN 67

  Fly    86 LLHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKPD 150
            :..:|.|.:|:.||:||||||||:|||.|.|:.:|||||||.||||.|:|.:|.|||:|||||||
plant    68 IKWFGVEGDYSVMVIDLLGPSLEDLFNYCNRKLTLKTVLMLADQLLNRVEFMHTRGFLHRDIKPD 132

  Fly   151 NFLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDME 215
            ||||||.|..|::|:|||||.|:|:|:::..|||||.::|||||.||||:|..:|||||||||:|
plant   133 NFLMGLGRKANQVYIIDFGLGKKYRDLQTHKHIPYRENKNLTGTARYASVNTHLGVEQSRRDDLE 197

  Fly   216 SMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFKE 280
            |:.|.||||..|.|||||:.|..|||||::|.|||.|..|..|||..||||.....|.|:|.|.:
plant   198 SLGYVLMYFLKGSLPWQGLKAGTKKQKYDRISEKKVSTPIEVLCKNQPSEFVSYFHYCRSLRFDD 262

  Fly   281 PPDHTYLRQIFRILFRSLNHHYDYIYDWTALQQQK-----------------------DQICRSR 322
            .||::||:::||.||....:.:||::|||.|:..:                       |.|.| :
plant   263 KPDYSYLKRLFRDLFIREGYQFDYVFDWTVLKYPQIGSSSGSSSRTRHHTTAKPGFNADPIER-Q 326

  Fly   323 EQIL------------------------ESEREEVRKRDGERGCEPQRDKERHKDLELDRLHKTS 363
            |:||                        .|.|:..|.|:.:.|   ...|:.|.|.|  |.:.:|
plant   327 ERILGKETTRYKIPGAVEAFSRRHPTTTSSPRDRSRSRNSDDG---PFSKQTHGDSE--RANSSS 386

  Fly   364 TQQAKCS 370
            ..:|..|
plant   387 RYRASSS 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 153/264 (58%)
SPS1 26..>266 CDD:223589 143/239 (60%)
ckl7NP_001330873.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 157/273 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.