DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and ckl8

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_199146.1 Gene:ckl8 / 834350 AraportID:AT5G43320 Length:480 Species:Arabidopsis thaliana


Alignment Length:413 Identity:177/413 - (42%)
Similarity:253/413 - (61%) Gaps:56/413 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFPTL 86
            ::||||:|.:.:||||||:::||:::..|.|||:|:|...|::|||.||:|:|..|....|.|.|
plant     4 VVGGKYKLGRKLGSGSFGELFLGVNVQTGEEVAVKLEPARARHPQLHYESKLYMLLQGGTGIPHL 68

  Fly    87 LHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKPDN 151
            ..||.|..||.||:||||||:|:|||.|.|||:|||||||.||::.|:|.:|.|||:||||||||
plant    69 KWYGVEGEYNCMVIDLLGPSMEDLFNYCSRRFNLKTVLMLADQMINRVEYMHVRGFLHRDIKPDN 133

  Fly   152 FLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDMES 216
            |||||.|..|::|:||:||:|:|:|:::..|||||.::|||||.||||:|..:|:|||||||:||
plant   134 FLMGLGRKANQVYIIDYGLAKKYRDLQTHRHIPYRENKNLTGTARYASVNTHLGIEQSRRDDLES 198

  Fly   217 MSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFKEP 281
            :.|.||||..|.|||||:.|..|||||:||.|||....:..|||.||.||.....|||:|.|::.
plant   199 LGYVLMYFLRGSLPWQGLRAGTKKQKYDKISEKKRLTPVEVLCKSFPPEFTSYFLYVRSLRFEDK 263

  Fly   282 PDHTYLRQIFRILFRSLNHHYDYIYDWTAL----------------------------------- 311
            ||:.||:::||.||....:.:||::|||.|                                   
plant   264 PDYPYLKRLFRDLFIREGYQFDYVFDWTILKYPQFSSGSSSSSKPRSSLRPAMNPPVPIAERPDK 328

  Fly   312 ------QQQKDQICRSREQ----------ILESEREEVRKRD----GERGCEPQRDKERHKDLEL 356
                  |..:|:...:.|.          :::::|...|..:    ..:...||..:...:.:..
plant   329 PSAGAGQDSRDRFSGALEAYARRNGSGSGVVQADRSRPRTSENVLASSKDTTPQNYERVERPISS 393

  Fly   357 DRLHKTSTQQAKCSNGHLTNRYD 379
            .| |.:|:::|..|:...|:..|
plant   394 TR-HASSSRKAVVSSVRATSSAD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 151/264 (57%)
SPS1 26..>266 CDD:223589 140/239 (59%)
ckl8NP_199146.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 155/273 (57%)
Pkinase 9..244 CDD:278497 137/234 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.690

Return to query results.
Submit another query.