DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and CKL6

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_567812.1 Gene:CKL6 / 828972 AraportID:AT4G28540 Length:479 Species:Arabidopsis thaliana


Alignment Length:398 Identity:183/398 - (45%)
Similarity:248/398 - (62%) Gaps:37/398 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFPTL 86
            :||||::|.:.||.||||:::|.:|:..|.|.|:|:|....|:|||.||:|:|..|....|.|:|
plant     8 VIGGKFKLGRKIGGGSFGELFLAVSLQTGEEAAVKLEPAKTKHPQLHYESKIYMLLQGGSGIPSL 72

  Fly    87 LHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKPDN 151
            ..:|.:.:|||||:||||||||:|||.|.||.:||.||||.|||:.|:|.:|.|||:||||||||
plant    73 KWFGVQGDYNAMVIDLLGPSLEDLFNYCNRRLTLKAVLMLADQLISRVEYMHSRGFLHRDIKPDN 137

  Fly   152 FLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDMES 216
            |||||.|..|::|:|||||:|:|:|:::..|||||.::|||||.||||:|..:|||||||||:||
plant   138 FLMGLGRKANQVYIIDFGLAKKYRDLQTHRHIPYRENKNLTGTARYASVNTHLGVEQSRRDDLES 202

  Fly   217 MSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFKEP 281
            :.|.||||..|.|||||:.|..|||||::|.|||.|..|..|||.:|.||.....|.|:|.|::.
plant   203 LGYVLMYFLRGSLPWQGLKAGTKKQKYDRISEKKVSTPIEVLCKSYPPEFVSYFQYCRSLRFEDK 267

  Fly   282 PDHTYLRQIFRILFRSLNHHYDYIYDWTALQQQKDQICRSREQILESERE--------------- 331
            ||::||:::||.||....:.:||::|||||:..:.. .||.....|..|.               
plant   268 PDYSYLKRLFRDLFIREGYQFDYVFDWTALKHPQSS-ARSHSSTHERHRTGKPGMGAGPSAEKPE 331

  Fly   332 ---------------EVRKRDGERGCEPQRDKERHKDLELDRLHKTSTQQAKCSNGHLTNRYDRI 381
                           |...|...||..|.::..||:.|:.....|.:..... ..|..|:||   
plant   332 RISVGNIRDKFSGAVEAFARRNVRGPSPHQNHTRHRTLDEIPSMKPAVNMVS-EKGRNTSRY--- 392

  Fly   382 GDGGISKR 389
              |..|:|
plant   393 --GSASRR 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 149/264 (56%)
SPS1 26..>266 CDD:223589 139/239 (58%)
CKL6NP_567812.1 STKc_CK1_delta_epsilon 12..286 CDD:271027 153/273 (56%)
PHA03307 302..>471 CDD:223039 20/104 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.