DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and CK1

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_194340.1 Gene:CK1 / 828716 AraportID:AT4G26100 Length:450 Species:Arabidopsis thaliana


Alignment Length:365 Identity:172/365 - (47%)
Similarity:237/365 - (64%) Gaps:21/365 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFPTLL 87
            :|.|:||.:.|||||||:||||.:|....|:|||:|....|:|||:||:|:|..|....|.|.:.
plant     5 VGNKFRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQGGTGVPNVK 69

  Fly    88 HYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKPDNF 152
            .:|.|.:||.:||||||||||:|||.|.|:.|||:||||.||::.|:|..|.:.|:|||:|||||
plant    70 WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKPDNF 134

  Fly   153 LMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDMESM 217
            ||||.|..|::|:|||||:|:|:|..:..|||||.::|||||.||||:|..:|:|||||||:||:
plant   135 LMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESL 199

  Fly   218 SYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFKEPP 282
            .|.||||..|.|||||:.|..||||||:|.|||.|.:|..||:|:||||.....|.|:|.|.:.|
plant   200 GYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKP 264

  Fly   283 DHTYLRQIFRILFRSLNHHYDYIYDWTALQQQKDQICRSREQILESE----------REEVRKRD 337
            |:.||::|||.||......:||::|||.|:.|:.|:.....:.|...          ...:.:..
plant   265 DYAYLKRIFRDLFIREGFQFDYVFDWTILKYQQSQLTAPPSRALNPAVGTSAALPPGISNIDRYT 329

  Fly   338 GERGCEPQRDKERHKDLELDRLHKTSTQQAKCSNGHLTNR 377
            ||....|..:..|.:           ...|..::|:::|:
plant   330 GEEEGRPHMESSRRR-----------VSGALDNSGNISNQ 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 150/264 (57%)
SPS1 26..>266 CDD:223589 140/239 (59%)
CK1NP_194340.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 155/273 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.