DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and CKI1

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_193170.1 Gene:CKI1 / 827076 AraportID:AT4G14340 Length:457 Species:Arabidopsis thaliana


Alignment Length:288 Identity:164/288 - (56%)
Similarity:220/288 - (76%) Gaps:0/288 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFPTL 86
            :||||::|.:.:||||||::|||::|..|.|||:|:|....::|||.||:|:|..|....|.|.|
plant    10 VIGGKFKLGRKLGSGSFGELYLGINIQTGEEVAVKLEPVKTRHPQLQYESKIYMFLQGGTGVPHL 74

  Fly    87 LHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKPDN 151
            ..:|.|..|:.||:||||||||:|||.|||.||||:||||.|||:.|:|.:|.|||:||||||||
plant    75 KWFGVEGEYSCMVIDLLGPSLEDLFNYCKRIFSLKSVLMLADQLICRVEYMHSRGFLHRDIKPDN 139

  Fly   152 FLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDMES 216
            |||||.|..|::|:||:||:|:|||::::.|||||.::|||||.||||:|..:|:|||||||:||
plant   140 FLMGLGRRANQVYIIDYGLAKKYKDLQTQKHIPYRENKNLTGTARYASVNTHLGIEQSRRDDLES 204

  Fly   217 MSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFKEP 281
            :.|.||||..|.|||||:.|..|||||:||.|||...::..|||.:||||.....|.|:|.|::.
plant   205 LGYVLMYFLRGSLPWQGLKAGTKKQKYDKISEKKMLTSVETLCKSYPSEFTSYFHYCRSLRFEDK 269

  Fly   282 PDHTYLRQIFRILFRSLNHHYDYIYDWT 309
            ||::|||::||.||....:..||::|||
plant   270 PDYSYLRRLFRDLFIREGYQLDYVFDWT 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 152/264 (58%)
SPS1 26..>266 CDD:223589 141/239 (59%)
CKI1NP_193170.1 STKc_CK1_delta_epsilon 14..288 CDD:271027 156/273 (57%)
PHA03307 <305..>436 CDD:223039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.