DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and ckl10

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_188976.1 Gene:ckl10 / 821915 AraportID:AT3G23340 Length:442 Species:Arabidopsis thaliana


Alignment Length:302 Identity:168/302 - (55%)
Similarity:224/302 - (74%) Gaps:1/302 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFPTL 86
            :||||::|.:.|||||||::|:|:::..|.|||:|:|....|:|||.||:|||..|....|.|.:
plant     4 VIGGKFKLGRKIGSGSFGELYIGINVQTGEEVALKLEPVKTKHPQLHYESKVYMLLQGGTGVPHI 68

  Fly    87 LHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKPDN 151
            ..:|.|.|||.|.:||||||||:|||.|.|.|||||||||.|||:.|:|.:|.|||:||||||||
plant    69 KWFGVEGNYNCMAIDLLGPSLEDLFNYCTRSFSLKTVLMLADQLINRVEYMHSRGFLHRDIKPDN 133

  Fly   152 FLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDMES 216
            |||||.|..|::|:||:||:|:|:|:::..|||||.::|||||.||||:|..:|:|||||||:||
plant   134 FLMGLGRKANQVYIIDYGLAKKYRDLQTHKHIPYRENKNLTGTARYASVNTHLGIEQSRRDDLES 198

  Fly   217 MSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFKEP 281
            :.|.||||..|.|||||:.|..||||||||.|||....:..|||.:||||.....|.|:|.|::.
plant   199 LGYVLMYFIRGSLPWQGLKAGTKKQKYEKISEKKMLTPVEVLCKSYPSEFTSYFHYCRSLRFEDK 263

  Fly   282 PDHTYLRQIFRILFRSLNHHYDYIYDWTALQ-QQKDQICRSR 322
            ||::||:::||.||....:.:||::|||.|: .|...|.:.|
plant   264 PDYSYLKRLFRDLFIREGYQFDYVFDWTILKYPQSGSISKPR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 152/264 (58%)
SPS1 26..>266 CDD:223589 142/239 (59%)
ckl10NP_188976.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 156/273 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.