DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and Csnk1g3

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_074046.1 Gene:Csnk1g3 / 64823 RGDID:621408 Length:448 Species:Rattus norvegicus


Alignment Length:377 Identity:162/377 - (42%)
Similarity:224/377 - (59%) Gaps:32/377 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFPT 85
            |::|..:|:.|.||.|:||::.||.::.....||||:|...::.|||..|.:.|:||....|.|.
  Rat    37 LMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQ 101

  Fly    86 LLHYG-CEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKP 149
            :.::| |.| |||||::|||||||:||:||.|.||||||||:..||:.|:|.||.:..|:||:||
  Rat   102 VYYFGPCGK-YNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKP 165

  Fly   150 DNFLMGLDRHCNK----LYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSR 210
            :|||:|  |..||    :::|||||:|.|.|.|::.|||||..::||||.||.|||..:|.||||
  Rat   166 ENFLIG--RPGNKAQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSR 228

  Fly   211 RDDMESMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRN 275
            |||:|::.:..|||..|.|||||:.|...|::|:||.:.|.:..|..||:.||.|....:.|||.
  Rat   229 RDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRR 293

  Fly   276 LGFKEPPDHTYLRQIFRILFRSLNHHYDYIYDWTALQQQKDQICRSREQILESEREEVRKRDGER 340
            |.|.|.||:.|||::|..||....:.:||.|||...|.........::..|.|.||..:.||   
  Rat   294 LDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQDPALSSNREAHQHRD--- 355

  Fly   341 GCEPQRDKERHKD------------------LELDRLHKTSTQQAKCSNGHL 374
              :.|:.|.:..|                  |..|| |..|.|....:||.|
  Rat   356 --KIQQSKNQSADHRAAWDSQQANPHHLRAHLAADR-HGGSVQVVSSTNGEL 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 133/269 (49%)
SPS1 26..>266 CDD:223589 121/244 (50%)
Csnk1g3NP_074046.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
STKc_CK1_gamma 42..329 CDD:271028 141/289 (49%)
CK1gamma_C 329..418 CDD:403712 19/82 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..375 9/37 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..417 5/13 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.