DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and Csnk1d

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_038942724.1 Gene:Csnk1d / 64462 RGDID:71031 Length:428 Species:Rattus norvegicus


Alignment Length:393 Identity:190/393 - (48%)
Similarity:249/393 - (63%) Gaps:36/393 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KLLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFP 84
            :|.:|.:|||.:.||||||||||||..|..|.|||||:|....|:|||..|:|:|:.:....|.|
  Rat     2 ELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIP 66

  Fly    85 TLLHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKP 149
            |:...|.|.:||.|||:|||||||:|||.|.|:|||||||:|.||::.|||.:|.:.|||||:||
  Rat    67 TIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKP 131

  Fly   150 DNFLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDM 214
            |||||||.:..|.:|:|||||:|:|:|..:..|||||.::|||||.||||||..:|:|||||||:
  Rat   132 DNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDL 196

  Fly   215 ESMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFK 279
            ||:.|.|||||||.|||||:.||.|:||||:|.|||.|..|..||||:||||...:.:.|:|.|.
  Rat   197 ESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFD 261

  Fly   280 EPPDHTYLRQIFRILFRSLNHHYDYIYDWTALQ-------QQKDQICRSREQILESEREEVRK-- 335
            :.||::||||:||.||......|||::||..|:       ...::..|.||:.|...|....:  
  Rat   262 DKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRAADDAERERRDREERLRHSRNPATRGL 326

  Fly   336 ---RDGE-RGCE--------------------PQRDKERHKDLELDRLHKTSTQQAKCSNGHLTN 376
               ..|. ||.:                    |....||.:.:.: |||:.:  ....|:..||.
  Rat   327 PSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPVSGMERERKVSM-RLHRGA--PVNVSSSDLTG 388

  Fly   377 RYD 379
            |.|
  Rat   389 RQD 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 159/264 (60%)
SPS1 26..>266 CDD:223589 148/239 (62%)
Csnk1dXP_038942724.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 163/273 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.