DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and csnk1g2b

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001039315.1 Gene:csnk1g2b / 561724 ZFINID:ZDB-GENE-060825-285 Length:444 Species:Danio rerio


Alignment Length:369 Identity:155/369 - (42%)
Similarity:221/369 - (59%) Gaps:20/369 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFPT 85
            |::|..:|:.|.||.|:||::.||.::.....||||:|...::.|||..|.:.|:||....|.|.
Zfish    37 LMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGNSEGVPQ 101

  Fly    86 LLHYG-CEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKP 149
            :.::| |.| |||||::|||||||:||:||.|.||||||||:..||:.|:|.||.|..|:||:||
Zfish   102 VFYFGPCGK-YNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEFVHTRSLIYRDVKP 165

  Fly   150 DNFLMGL--DRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRD 212
            :|||||.  .:..:.:::|||||:|.|.|.|::.|||||..::||||.||.|||..:|.||||||
Zfish   166 ENFLMGRPGSKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRD 230

  Fly   213 DMESMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLG 277
            |:|::.:..|||..|.|||||:.|...|::|:||.:.|.:..|..||:.||.|....:.|||.|.
Zfish   231 DLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRLD 295

  Fly   278 FKEPPDHTYLRQIFRILFRSLNHHYDYIYDWTA--LQQQKDQICRSREQILESEREEVRKRDGER 340
            |.|.||:.|||::|..||......:|:.|||..  |......|.....|   ..|::.:.:...:
Zfish   296 FFERPDYEYLRKLFTDLFDRNGFVFDFEYDWVGKPLPTPIGPIPTDTPQ---PSRDKAQPQTKNQ 357

  Fly   341 GCEPQRDKER----------HKDLELDRLHKTSTQQAKCSNGHL 374
            ..||:|.:.:          ...:..:|| ..|.|....:||.|
Zfish   358 SPEPKRSESQPTPVTNRETLGSQVTAERL-GGSVQVMSSTNGEL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 132/267 (49%)
SPS1 26..>266 CDD:223589 120/242 (50%)
csnk1g2bNP_001039315.1 SPS1 42..411 CDD:223589 153/364 (42%)
STKc_CK1_gamma 42..329 CDD:271028 139/287 (48%)
CK1gamma_C 329..403 CDD:289378 14/76 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.