DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and vrk3

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001013586.1 Gene:vrk3 / 541443 ZFINID:ZDB-GENE-030131-246 Length:459 Species:Danio rerio


Alignment Length:224 Identity:58/224 - (25%)
Similarity:101/224 - (45%) Gaps:32/224 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 GFPTLLHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRD 146
            |.|:.:.:|..:.|..:|...:|..|:...:......|.|.||.|..:||..:|.:||:.:.|.|
Zfish   236 GIPSCVGFGLHETYRFLVFPCMGQPLQTELDEGTGSLSEKNVLQLALRLLDSLEFIHEKEYAHAD 300

  Fly   147 IKPDNFLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLT--GTVRYASINAQIGVEQS 209
            |...|..:....| .:::|..||.:.|:  .....|:.||......  |.:.:.|:::..|...|
Zfish   301 IHAGNIYIKSSSH-TEVFLSGFGHAFRF--CPGGKHVEYRQGSRTAHQGNISFISLDSHKGAGPS 362

  Fly   210 RRDDMESMSYCLMYFNLGKLPWQGI-----TAANKKQKYEKIL---------EKKTSVTIAQ-LC 259
            ||.|::|:.||::.:..|.|||..:     :.|.:|::|...:         :||.|..:.: ||
Zfish   363 RRSDLQSLGYCMLCWMTGSLPWSHLSHNSSSVAAEKERYMSDVPGLLTYCYKQKKASSALQEYLC 427

  Fly   260 KGFPSEFCLLMTYVRNLGFKEPPDHTYLR 288
            .            |..|.:.|.||:|.|:
Zfish   428 N------------VMALQYTEKPDYTLLK 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 58/224 (26%)
SPS1 26..>266 CDD:223589 51/200 (26%)
vrk3NP_001013586.1 DUF4758 <9..>104 CDD:292572
PK_VRK3 154..451 CDD:271026 58/224 (26%)
SPS1 236..>384 CDD:223589 41/150 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.