DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and VRK3

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_057524.3 Gene:VRK3 / 51231 HGNCID:18996 Length:474 Species:Homo sapiens


Alignment Length:283 Identity:70/283 - (24%)
Similarity:124/283 - (43%) Gaps:53/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KNDAKYPQLIYEAKVYEQLAR------------CP--GFPTLLHYGCEKN-YNAMVMDLLGPSLE 108
            |.|||..:|..|...:::.|:            .|  ..||.:.:|..:: |..:|:..||.||:
Human   203 KLDAKDGRLFNEQNFFQRAAKPLQVNKWKKLYSTPLLAIPTCMGFGVHQDKYRFLVLPSLGRSLQ 267

  Fly   109 ELFNLC-KRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKPDNFLMGLDRHCNKLYLIDFGLSK 172
            ...::. |...|.::||.:..:||..:|.:||..::|.::..:|..:..:.. :::.|..:|.:.
Human   268 SALDVSPKHVLSERSVLQVACRLLDALEFLHENEYVHGNVTAENIFVDPEDQ-SQVTLAGYGFAF 331

  Fly   173 RYKDIESEIHIPY----RTDRNLTGTVRYASINAQIGVEQSRRDDMESMSYCLMYFNLGKLPWQG 233
            ||  ..|..|:.|    |:...  |.:.:.|::...|...|||.|::|:.||::.:..|.|||..
Human   332 RY--CPSGKHVAYVEGSRSPHE--GDLEFISMDLHKGCGPSRRSDLQSLGYCMLKWLYGFLPWTN 392

  Fly   234 I---TAANKKQKYEKILEK------------KTSVTIAQLCKGFPSEFCLLMTYVRNLGFKEPPD 283
            .   |....||| :|.::|            :.|.|:.:..|           .|..|.::|.|.
Human   393 CLPNTEDIMKQK-QKFVDKPGPFVGPCGHWIRPSETLQKYLK-----------VVMALTYEEKPP 445

  Fly   284 HTYLRQIFRILFRSLN-HHYDYI 305
            :..||.....|.:.|. ..||.|
Human   446 YAMLRNNLEALLQDLRVSPYDPI 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 65/266 (24%)
SPS1 26..>266 CDD:223589 59/241 (24%)
VRK3NP_057524.3 zinc_ribbon_2 4..26 CDD:289981
DZR 5..>31 CDD:289539
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..152
Nuclear localization signal. /evidence=ECO:0000269|PubMed:14645249 49..64
DUF4551 <82..>150 CDD:291746
PKc_like 155..457 CDD:304357 65/270 (24%)
SPS1 211..>467 CDD:223589 64/272 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.